SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339554|ref|YP_001520943.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339554|ref|YP_001520943.1|
Domain Number 1 Region: 48-338
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.82e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0093
Further Details:      
 
Domain Number 2 Region: 1032-1234
Classification Level Classification E-value
Superfamily TPR-like 1.14e-18
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 3 Region: 448-609
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 4 Region: 951-1067
Classification Level Classification E-value
Superfamily TPR-like 0.00000000209
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 5 Region: 1153-1189,1257-1337
Classification Level Classification E-value
Superfamily TPR-like 0.0000000135
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Weak hits

Sequence:  gi|158339554|ref|YP_001520943.1|
Domain Number - Region: 613-632,667-695
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00169
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number - Region: 342-420,449-469
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0116
Family Filamentous hemagglutinin FhaB, secretion domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339554|ref|YP_001520943.1|
Sequence length 1756
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MTSGFWLGATLTPFLFSDIALAQVIVPDDTLGMEQSAVSTGATANDFVIDGGAQRNTALF
HSFKQFSINSNQTVFFENPASVDNIITRVTGGLPSNIDGLLGVDGPANLFLANPSGIIFG
PNAQLDVAGAFMATTADQFLFANGTSFNAVNPNAPPLLTISVPLGVKFGANPQPISVNGA
TLRAGVGEPLVLLGGDVALNDANILAPGGHVGLSGLSQPGTISFNLDATSPQSFLTVPPL
GQTNLSLNNSNINTVSEGSGDIVLQAQNISFIETTLLAGLNEDVDSFDTQGGSILVKGTG
DIQLSGSIIQTFVEENGQGGDIHMNATNRLFLSGESEISSLAEGFESDAGAIFINTPDIR
LNSGSRIASVTQASGGDINLTTHSLLVRQNSDIATTKFGPNTSDGNIRIRANNILIDDRG
GDRNRPPIGITADVSFIPQDLGLPPEMIGGTGGNIEIDTQNLTLIGGLIGSTVFGNAQGG
NLTIRARDTVRLVGDPAAARDNFAGIADVSTAIRDATLEGVSGDLRIDARHLILANGSTI
DAGAFGFGNSGDILINTTESVTLQGTLNGQPSRIITQLQNSGPFDGGNIDLVTGRLTLQD
GGQISASTIAESEGNGRDVSIIANQGIFITGSSPRIELPPGNADSPFVLDPTGTRFPSGI
FASSPGEGNAGNVDIFSPNITVSNGAQISVSSTNAGAAGSLFIRGNNVVLDNAALLAEAV
EGNLANIELSVRDSLQLLNGSRISTVARGDADGSNIIISGTDTQLLRFLIFKGGSTISTE
NSGRFGNGGDIDIAAQFILAFPGELNQIIANAVEGDGGEINIFTNAIFGRQFLNISASSK
LGVNGDTIIETIETDPTNSLTQLPENVLDNSTQVADACAVPRSGQSQFIVTGRGGLPLMP
SSRPVGRYLLSDLRTQAPQDGKQVLQEAKQLVVTARGDYYLQGESSRSLPQLLEAARQEY
QQAKYPEAITYWTQAVNQLSKSKHPGAYASVQSHLALAYHHLGDWDKAREAMAASQAVLT
PELIAQQPALHAQVLNTRASLFLTRGNIQAALEDWQQAAAVYQRAGDDLGNLQAQLNQIQ
VLQDLGYLRQTQQRLVQLMQPLEQQPPSPVKAIGQLNLGKVSRAEGNLLRSQRQLEAALT
TAQSLNQLALTSTILLNLGHTFRGQGNTQKALGYYQQAREIAPTSLIQFQVQVSRYDLLV
VQKDPAASTIFQELQVQAQQLPSSREGIYAQLHLIETVLDSKLDESQALLNLLSRIQAQA
QELDDPNAQSYILGYQGRIYGQAQQWSQALSLTEQALQRVQRQQAPEVLYQLAWQLGRYR
RQLGNRQGAISAYLDAVAALRSLRGDLSTASDDVRFTFRDGVEPVYRELVALLLEGDMNQ
TEASSNLTQARKLIEDLQLNEIQDYFQDACVQAQPLAADQVDPKAAVIYPIVLKDRVDVI
VSIGNQPLRHYSTPIEPGQVDTTVNQLLRSLTTPLGSVQKNNLTKLKLIYDWVIDPASAD
LAQQDIETLVFVADGALRTLPLTTLYDGEQYLIEKYNVALSPGLELLAPRSQDRERVKLL
VGGVSEARSGFPALPFVAKEVEQITAQIQDNDVLLNQDLTRDNLNDYLTEVSSEVVHLAT
HAEFGASPEDTFILTWEGKLSIQAMASLLRSRSLMSEVPIDLLVLSACETATGNSRAVLG
IAGMAIRSGVRSTLAGLWSLDDQAAAAFMGHFYQALAQPNTTKASAFRQAQLALMKNPKF
RAPYFWSPFVLVGNWL
Download sequence
Identical sequences A8ZKU3
WP_012166786.1.67183 gi|158339554|ref|YP_001520943.1| 329726.AM1_A0293 gi|158339554|ref|YP_001520943.1|NC_009926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]