SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339888|ref|YP_001521058.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339888|ref|YP_001521058.1|
Domain Number 1 Region: 30-114
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000164
Family PYP-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339888|ref|YP_001521058.1|
Sequence length 131
Comment hypothetical protein AM1_B0018 [Acaryochloris marina MBIC11017]
Sequence
MTSGPEFPFSSDSVLSETSGDKQHALQLKPQQLLDRLPVTVWQANDQGQIISLSARWQLI
TGHAPIESLGEAFWNAVLLEDRDLSFQQWTNACQQQQPFVLHLHLCSIKGKPDPFLIQGV
AGWVRCSQRML
Download sequence
Identical sequences A8ZLX5
WP_012166898.1.67183 329726.AM1_B0018 gi|158339888|ref|YP_001521058.1|NC_009927 gi|158339888|ref|YP_001521058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]