SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339955|ref|YP_001521125.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158339955|ref|YP_001521125.1|
Domain Number - Region: 83-124
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.00165
Family AbrB N-terminal domain-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339955|ref|YP_001521125.1|
Sequence length 125
Comment hypothetical protein AM1_B0085 [Acaryochloris marina MBIC11017]
Sequence
MPRKKKQTKPLTGKDLVAKVKQLSDYTREEKAKACGYISADKDGSERIKTIAFLNALLDA
EGIDLDSQSPNGNGNSGRKASYKVSVQSNGNILVGRTYTQALELEPGDEFEIAVGRKHIH
LTKVA
Download sequence
Identical sequences A8ZM42
gi|158339955|ref|YP_001521125.1| 329726.AM1_B0085 gi|158339955|ref|YP_001521125.1|NC_009927 WP_012166963.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]