SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158340010|ref|YP_001521180.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340010|ref|YP_001521180.1|
Domain Number 1 Region: 32-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-27
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.078
Further Details:      
 
Domain Number 2 Region: 207-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000013
Family FAD/NAD-linked reductases, N-terminal and central domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158340010|ref|YP_001521180.1|
Sequence length 401
Comment hypothetical protein AM1_B0141 [Acaryochloris marina MBIC11017]
Sequence
MGWGRWLILKNYDNDNHYIKILLAASLSMKETTSSYDVVIVGAGPAGVGCAVALQDLGLK
NFILLERQQVGASFSRWPAEMNLITPSFPSHGFGLLDLNAITLKTSPAVAFRREHINGQQ
YALYLQTVANHFQLPVKTETDVLDIEPLSQCRGFILKTSGGDIKTQFVIWAAGEFQYPRL
NPFVGADHCIHNSQIRSWKNLPGDEFTIIGGYESGMDAATNLVALGKSVRVLDRTGAWDN
PDTDPSIALSPYTVQRVKLAVQTGRLELIGNVSIEEVKKVSEGYAVFSEYHKWLTAHPPI
LCTGFETSLQQIASLFDWSEGYAMLNDQDESTLTPGLFVVGPSVRHHDVIFCFIYKFRQR
FAVVADAIARRLDLDPAPLEIYRQQGMFLDDLSCCDNDCIC
Download sequence
Identical sequences A8ZM97
gi|158340010|ref|YP_001521180.1|NC_009927 gi|158340010|ref|YP_001521180.1| 329726.AM1_B0141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]