SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158340164|ref|YP_001521334.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340164|ref|YP_001521334.1|
Domain Number 1 Region: 6-310,337-364
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.04e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.0045
Further Details:      
 
Domain Number 2 Region: 442-525,560-587
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000596
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 
Weak hits

Sequence:  gi|158340164|ref|YP_001521334.1|
Domain Number - Region: 591-693
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00785
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158340164|ref|YP_001521334.1|
Sequence length 821
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MYFLLFSGIAQAQIIPDSTLPNNSRVSVNQQKYVITGGSRSGVNLFHSFDTLSVPSHRTA
HFLNDISIQNILARITGTSMSNINGTLQANGAANLFLINPNGIIFGPRSQLSLGGSFIAT
TANRIDFLDGKKLDLNSINEISLLSKSLPVSLSIDSSSGSITIQGTGNSLQRANPLPAGS
PIVDSPLSIPFQTPNQTLAFVGRNIIFNGGVVASPSGNLVLSSVDEGEVGISLDPTGFQF
NDEKIVHFADVTLSNKSLLTATGSPSGNIFIRGKNLLINDQSLVISSNYSSNNNSQININ
LSGDLVIQGVQDPAALTVSLSDGTVPYGGIVSQNFSSYTGPNIKVSSQNGVLTSYGFINS
FNFAGGTGGKIDFSIDNSLLIDGTSPIPLNFRPSSITSLTTNGNAGGIKGQGRQLTITGG
GFISSSTTSSSPLSLGDTGDIKVTFDDISISGGSPISIGPDLPLSFNPSFIGTTTVSPGD
AGNIFLKVDNLTIVDGGRINSTTTNSGDAGNIEIDVQGSLILQGKIPGSDDFRDSSQIIS
SSERTNEFFRALFQLPDIPTGEPGSIRITANSILVKDSGRVNVRNDGPNDAGNISLQAQN
IQVDNASLLATALGNGGNIQLLSNFLLLNNGTISASAKGDGPGGNIQIDADVFVGLGSNN
ISANAINNRGGNIQINTVGLFLSPDTKITATSASGTQQEGSVTVNTQRTDAEETTSAAPN
VERSPKVVSACNPTQGRSSFVVLGPGNQKAKAHDIATTDVPWNASQMQLASNSEGNQTAP
DLPVIQEAIGWQKIDGKLVLIAEHQDQTTRIASQAATCDKT
Download sequence
Identical sequences A8ZLJ3
gi|158340164|ref|YP_001521334.1|NC_009927 WP_012167168.1.67183 gi|158340164|ref|YP_001521334.1| 329726.AM1_B0301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]