SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158340201|ref|YP_001521371.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340201|ref|YP_001521371.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000000016
Family TTHA0281-like 0.075
Further Details:      
 
Domain Number 2 Region: 72-111
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00001
Family Omega transcriptional repressor 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158340201|ref|YP_001521371.1|
Sequence length 113
Comment HicB family protein [Acaryochloris marina MBIC11017]
Sequence
MKNMMEYQGYFGSVNFSDEDEVFFGKVEFIRSLISYEGTDVQSLKSAFHGAVDEYLADCT
ENEIEPERPFKGSFNIRPGTQLHRRAAIAAQQRGINLNALVTEALENYLQPSK
Download sequence
Identical sequences A8ZLN0
gi|158340201|ref|YP_001521371.1|NC_009927 329726.AM1_B0339 gi|158340201|ref|YP_001521371.1| WP_012167204.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]