SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158340895|ref|YP_001522063.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340895|ref|YP_001522063.1|
Domain Number 1 Region: 801-1202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.05e-121
Family PFOR PP module 0.0000000268
Further Details:      
 
Domain Number 2 Region: 422-674
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000496
Further Details:      
 
Domain Number 3 Region: 7-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.24e-71
Family PFOR Pyr module 0.0000000624
Further Details:      
 
Domain Number 4 Region: 261-417
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.99e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000784
Further Details:      
 
Domain Number 5 Region: 671-845
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.88e-24
Family Ferredoxin domains from multidomain proteins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158340895|ref|YP_001522063.1|
Sequence length 1207
Comment pyruvate-flavodoxin oxidoreductase [Acaryochloris marina MBIC11017]
Sequence
MKNSTCTTLDGNEAVARIAFFLNELIAIYPITPVSPMAEWADTWTEANNKNLWGVVPLVV
EMQSEAGVAGAVHGALQMGALTTTFTASQGLLLMIPNLFKIAGELTSTVFHIAARSVAAQ
ALSIFGDHSDVMAARGTGFAMLSAASVQEAQDFAAIATAATLETRIPFLHFFDGFRTSHE
IQKVELLSIATLKELIQDKSVMAHRARALSPDHPVLRGTAQNPDIYFQARETVNPYYLDC
STVTQTVMNDFAQLTGRQYQLFEYHGHPEAERIIVLMGSGCETVHETVDALNRQGDQVGV
IKVRLYRPWDAQRFITALPPSTQSIAVLDRTKEPGSLGEPLYLDVLATLSEHSSHLSVQK
VVGGRYGLSSKEFTPAMVKGIFDHLATTNPKNHFTIGINDDVTLTSLPYDSSFSTDSDQG
MRAIFYGLGADGTVGANKNSIKIIGEHTDHYAQGYFVYDSKKSGSVTVSHLRFGPDPIRS
TYLIEQANFIACHHWDFLDKIDVLKAAQPKAIVLLNSPYPATEIWERLPAHVQQQVLQKH
LKLYGINANQIAQAVGMGGRINTVMQVCFFVLSDILPRDVGVACIKESIHQTYGKKGEEI
VRMNLKAVDAALEQLYKVPMDDSIGQLKVNNSQASTMPETAPKFVREVLNYMIQRQGDML
PVSALPADGTYPTGTAKWEKRNIAQFIPVWDPEVCIQCGKCVMVCPHSVIRSKVYDPEHT
EKAPTTFKSTAARDHAWSDLKFSIQVAPEDCTGCGICVDVCPAKNKSKPRLKALNMEPQR
PLRETEVQNWDYFLTLPHPQRQSLNLHKISHQQMQQPLFEFSGACAGCGETPYIKLITQL
FGDRMVVANATGCSSIYGGNLPTTPWTVNADGRGPAWSNSLFEDNAEFGLGFRVAIDQQK
ELARKLLEEVVNTIEDEHDYIQFLAERLLAAKQDDEADIAEIRQEVVLLKQWLTEQEIHL
ESHKNDRRDNSLIEKMSQLKALADYFVKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNI
LVLDTEVYSNTGGQMSKSTPRAAVAKFAAGGKPTPKKDLGLMAMTYGNVYVASVAMGARD
EHTLKAFIEAESYEGPSLIIAYAHCIAHGIEMSSAMHHQKSLVDAGRWLLYRHDPRRVTQ
GQNPLVLDSHAPKVPINPSMYAENRFKMLTRSQPETAQQLLQEAQQDVNTRWLLYQYLAA
RPQRSQS
Download sequence
Identical sequences A8ZP13
gi|158340895|ref|YP_001522063.1|NC_009929 WP_012167642.1.67183 gi|158340895|ref|YP_001522063.1| 329726.AM1_D0258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]