SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158340955|ref|YP_001522122.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340955|ref|YP_001522122.1|
Domain Number 1 Region: 18-354
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.18e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.0052
Further Details:      
 
Domain Number 2 Region: 330-410
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158340955|ref|YP_001522122.1|
Sequence length 620
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MNQSILLTSALAIWSVLLTPGLAQVSADRTLGNENSVIEQQRNRILIKGGASRNKSLFHS
LKDLSIGTGQEVYFSNPNNINLILTRVTGGNPSNINGTLGVLGDADLFLMNPSGIYFGPN
SFLDLNGSFLATTGSRFIFKDGKSFSAINPQPVQNLKLSIPIGIQFGNTAQDINIQSVYV
VDPSITTCMNLCFSEYPNLRVKPRNTISILGGGINFLRGGIQVLNGNIEIGSVAPRSYVS
LQPTNQGWLLGYEDVGSFKDINVKNSSKILIDSSDSSRNKYLRINSRNLNVENNGLIDTY
SYFNGTGGNIFINTRNALNIDNSGTISSNSYQSSSGGNILINSKNTTLENMGKISSNSNV
FGKAGNITIASKEILLRDNAEIGLFSSNAPGGSLSITGNNLTLEDNASISMIVENQRLGD
LNIELDNILLLRNKSKIKYDANGLGIGGLIDFDVRLLVGLEESLIEIDAPLTQFNIESLG
FFDSNGQFIIDAAEKYKESLAQPKDVIKSCRPGQSLGNSTFVNVGRGGVPLGPHHIQTPP
SIWQDLREPQISPQNSPSSTITETSNLTKRETYNQSLTPASNPTIVEAQRWIRDKQGRVV
LTANTSKLMTYNSGQSVASC
Download sequence
Identical sequences A8ZP72
WP_012168042.1.67183 gi|158340955|ref|YP_001522122.1|NC_009930 gi|158340955|ref|YP_001522122.1| 329726.AM1_E0038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]