SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341055|ref|YP_001522222.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341055|ref|YP_001522222.1|
Domain Number - Region: 72-91
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0212
Family Intron-encoded homing endonucleases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158341055|ref|YP_001522222.1|
Sequence length 127
Comment hypothetical protein AM1_E0139 [Acaryochloris marina MBIC11017]
Sequence
MPMIRARYPDNWDEIALQVKEDANWRCTECGKPCRKPGVEWLHFAFWLMITHPEWFPITS
EGEEQKPQRFTLTVAHLDQDPQNNHPDNLKALCAPCHLKFDAPFRKANAYTKQEWFGQMK
LEDLTNG
Download sequence
Identical sequences A8ZPH2
WP_012167945.1.67183 gi|158341055|ref|YP_001522222.1|NC_009930 gi|158341055|ref|YP_001522222.1| 329726.AM1_E0139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]