SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341209|ref|YP_001522427.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158341209|ref|YP_001522427.1|
Domain Number 1 Region: 61-328,362-391
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.21e-38
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 458-537,574-604
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000565
Family P22 tailspike protein 0.08
Further Details:      
 
Weak hits

Sequence:  gi|158341209|ref|YP_001522427.1|
Domain Number - Region: 607-712
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0091
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158341209|ref|YP_001522427.1|
Sequence length 843
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MNYRSLLEKPFLALGFLLLSANHVNPQILPDTTLGPESSISMPNQLINGIPSIRLTGGAT
RGSNLFHSFLEFSINNGQAVYFDNPLSVKTILSRITGNKVSLINGVLGSTSNADLFFVNP
NGIIFGRNAVLDINGSFFGSTANHLRFMDDSIFSANQTHQAPLLTNSLPKSLEFEGGNGP
IQVIGEGNRLTDFTILPIFNPFDRPLGLALRPQNTFALIGGEIQSQGGVIRSSSGRIELS
SITKGKVLLNQLNSDWTFEYSEVDSFGDIALNQRSLIDTSGLVGGPINLQAKNILLNDGS
TVLIQNLGNLPSSDITVNATDTVTVSGVSNDPRFTLPEIALIAGDELNVKIPSTFLTEAL
GLGTSGNIKIFSPTILVNGGGQILARTNGPGTAGDITITSPESVQIDGFAPNLPVVFSNI
STATFNRGNAGNLAIFTNQLLVTNGANVGSSTFGLGNGGDVLINAKDITLKGIVPVLFIP
SAISSATFSFGSAGTLTLNTSTLTLLDGGRLGTSTVSSGNAGKVTINASQLIKVSGTVPG
SINPSLIDSSANIVDPALREQLGLPGAPLPNIPSGTAGDVTIRTKTLLVNNGGLISVRND
GTGDAGTLRIFADSIKLENRGNIAASTAVGNGGNLVFQIQDLLFLNQSSNITTSAQKFGI
GGNIDINSGVIALSNNSVISGNAEQASGGNIRIETQGIFVSSDSKITASSQLGPQFSGNI
EINTPNIDFTKATLDLAVRPEVEEVAISCNIDPGEVASEFTRPGSGGVASNAEKTGELRV
VKNRNNNLQTQEYYLDPETGEPKVYPKVVGWKRNPNGTIAMTSDPTEAVQTQAFCSRTAH
NNL
Download sequence
Identical sequences A8ZPR6
329726.AM1_F0123 gi|158341209|ref|YP_001522427.1| WP_012168186.1.67183 gi|158341209|ref|YP_001522427.1|NC_009931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]