SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341225|ref|YP_001522411.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341225|ref|YP_001522411.1|
Domain Number - Region: 286-300,333-379
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0706
Family Intein (protein splicing domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158341225|ref|YP_001522411.1|
Sequence length 404
Comment hypothetical protein AM1_F0107 [Acaryochloris marina MBIC11017]
Sequence
MRIKGLLKASHQVRDQLKIGIPINEVPQFKQYVKDSIKVTEQICAKAKTSPNQLPLPSRK
AYKFLKSVDLKNLPIIQQCSTLQSQKRISIRQIRPQHQRLQRQIAEVANGSGLNSKQGQD
LVQQLQHTAQDIEVLCNRQVATPANLTGQSRQIYCWIKFLLSDDNLQSHLNAVQTFYQLL
QLGLEQKKPSDNTNWQQLKDPKNLSIEFAHISALYRCKLGTEQGSIKVNEGFILADELIL
EALVNSILNGKTPKTTSVFYEYSLSEEFAELLMEMELLVEDLNETAQGSTYNLEEVYQKV
NQAYFDGTLDKPKLCWSRTYSKRKFGHYEPSRDQVVISLNLDTKKVPRYVVEFVMYHELL
HKVHGHRTQNGRQMAHTPEFRRDERLFQKYLQAEEHLQRLARAS
Download sequence
Identical sequences A8ZQ88
WP_012168170.1.67183 329726.AM1_F0107 gi|158341225|ref|YP_001522411.1| gi|158341225|ref|YP_001522411.1|NC_009931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]