SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341333|ref|YP_001522498.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158341333|ref|YP_001522498.1|
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.77e-40
Family Filamentous hemagglutinin FhaB, secretion domain 0.013
Further Details:      
 
Domain Number 2 Region: 489-880
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-20
Family Galacturonase 0.082
Further Details:      
 
Domain Number 3 Region: 1105-1184
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000246
Family Invasin/intimin cell-adhesion fragments 0.0046
Further Details:      
 
Domain Number 4 Region: 1004-1081
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000167
Family Invasin/intimin cell-adhesion fragments 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158341333|ref|YP_001522498.1|
Sequence length 1261
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MQPAHAQSIVTEPNGTQTIVTADGKRFNISGGSLSGDGANLFHSFKKFGLSQGEIATFLS
NPGIQNILGRVNGGDASIINGMIQVQGSNANLYLMNPAGIVFGPNATINVPADFRATTAD
GIGFEKGWFNAVGDNDYAALEGTPQSLLFNTDQPGSIVNAGHLAVAKGQNLSLIGGTVVN
TGSLSAEGGQVTLAAVPGQRRVRINHPDMLLSLEVNQLDPDTTENARAVSLSELLTGGDI
PVATGVEVDAEGRTWLLNTPVVNGDVAIAGDVTGNQVQLAAANRINVMGDSEKLITTHNG
QHSAPIVTRFNADGTNANELVFLDTTVPDYQRLLFGTEAGTTTVAIPVSENGIERVTSVL
QQVGAVDAVHIVSEGDEGEFWLGNAYVSNETLDKYKAHFQQWGGLLSTEADILIYACLTA
RGPEGLALLNKIAELTHADVAGSTDLTGDTARGGNWILEQSIGSIETGSAFEATTLADYT
GLLQVFTATDAASLIAAINTANGNTETDTINLANNITLAAVDNATNGANGLPSITAPEKL
TINGMGNTLARDTTAPDFRLIHVALGAELEVNDITLTGGIANSGGQGDDGGAIHNRGTLT
VNNSIITGNTAADDGGAISSFNTTANAVTVTINNSTLSGNTAMGNGGALSNTSFTGAGPN
STVMTVNNSTITGNNANVGGGIAQLGQNANNSAVVIVNNSTISGNTVVFGGGGIYNRGQT
SLLGATITITNSTIVQNEVTNPGSSSGGILNLNFLGGANTARVTVANSIIALNTATVFPD
VRRASATNSPIIDGGNNLIGVDNQGIFTTSTLVGSVATPLDPMLLPLGDYGGPTQTHAFF
LDSPALNAGSDALAMAATLTTDQRGANRFNGTVDIGAVESQGYSLAVTAGNNQTTTVNTA
FTTALEAQVTENFANSPLPVSGLNVTFTATPSPTGATGSFNGNPTTTVVTNATGVATAPT
LTANTVAGSYVISSSSGTLTPASFNLTNTPDVPALLTISGGNDQSTTVNTAFADTLDVTV
TDQFGNLVPNTTLNYSAPNTGASSTLSATTATTDSNGVASVSATGNTVAGSYVISSSSGT
LAPVSFNLTNTPDVPALLTISGGNNQSTTVNTAFANTLDVTVTDQFGNLVPNTTLNYSAP
STGASSTLSATTVTTDNNGVASVSATANDTAGTFTVTATGVGVTAGNFTLTNSPIAPTTP
DIPATEFLGFWTDLQELSKTSDVACGAVPTVNLEVDIDIPDVQGQTPPPEESQQALGADC
P
Download sequence
Identical sequences A8ZQ98
gi|158341333|ref|YP_001522498.1| WP_012168253.1.67183 gi|158341333|ref|YP_001522498.1|NC_009932 329726.AM1_G0004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]