SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341336|ref|YP_001522501.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158341336|ref|YP_001522501.1|
Domain Number 1 Region: 335-504,556-741
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000421
Family Galacturonase 0.0047
Further Details:      
 
Domain Number 2 Region: 696-964
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000197
Family Galacturonase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158341336|ref|YP_001522501.1|
Sequence length 1022
Comment hypothetical protein AM1_G0007 [Acaryochloris marina MBIC11017]
Sequence
MALFCDRIAITAITLTVFYSLPTIAEPQPSTQASDLRFSPRFGIGANSPSSGTNTTTRLE
TFVPVWQKPGRALTFFEGRLLLDDQGNPGGNILFGFRQYSDDLKRIFGGHLGFDIRNTDN
NTFQQLSLGIESLGKDIDLHLNGYWPVGSTRRQTRQRIFEVLQLNGDPRFTGNILLLDLL
RRRLITRQFEEALAGVDFEVGKQLLSFKNGGDLRAYLGPYFLHSSIRGNTIGGRLRLQVR
PTPNISGGIGIQHDDFFGTHVLGNITFTLSVNQPQSPVSPANNVVARMGDSVIRNNSIIV
DTPNTTELLETETQTVAAMNPTTGEPWFFHHVNLGLGNSDGTFESPFPSLEDALGVIRGD
GNDIVYVANGINSGIEGFTIPDKVQVRSRGAVQQIDVNPISFPLRPESVLRLGQVQLPFS
GDSSFPRITSTVSLGNNTLLSGFDVQVTGAPALVANNITTATVIDNSLASTNSTTNGISI
NGISGSLNLDNNAINIDNPAMAGVDISNVSASTGSVRIVGTSGSRIQRTGRDGVVLGNNT
TIANLNIAPLPNNVDFSGNRGIFGRNVRNVRVQNNQIIVIGRDFSPGIKLENITGSAEII
NNQITRNPIFVDPAAPGISHGISLSLSNINLDRVVISENTIKTTGISTDGIVIQSLNDSA
IQSVTISGNTIETNGVQSDGIVVQSSNNSTIQSANISGNTVETAGLNSQGISVRPIYNSV
ITTATISGNTVSTDRIFSYGILVEPFNKSTITTATISENTVSTTGIADGILLRPGYNSAI
TTTTISGNKISTAGLISDDMVLRPFFTIPSTTASINIRPTTNSVISTAIISGNTVSTTGL
AYGINVQPSQNGTITVATISGNTVSTDRFNAAGIRVQPYIDSTINKATISGNTVSTSGKN
ADGILVRPVGNGAIQSATISNNKILQAGRDSVRIQARQDSLRIGNYDVNPICAAISGNRS
DNPNVAMAGGLDFNLISARSPFQVESLTTVSLDNNNAIFSFDGTLVPPGTPSSPFTNVVS
CP
Download sequence
Identical sequences A8ZQA1
329726.AM1_G0007 gi|158341336|ref|YP_001522501.1| gi|158341336|ref|YP_001522501.1|NC_009932 WP_012168256.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]