SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341358|ref|YP_001522523.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341358|ref|YP_001522523.1|
Domain Number - Region: 51-97
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.023
Family CopG-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158341358|ref|YP_001522523.1|
Sequence length 101
Comment hypothetical protein AM1_G0029 [Acaryochloris marina MBIC11017]
Sequence
MARKPLNQAAKAFLSGEATDVEASVETVTPTTTTPTEVKDDAPNGLIDSLSLTPQEKPAP
MTITILPSRKNKLQQLSQSTGRNMSELIGIALDRMFNDANI
Download sequence
Identical sequences A8ZQC3
329726.AM1_G0029 WP_012168278.1.67183 gi|158341358|ref|YP_001522523.1|NC_009932 gi|158341358|ref|YP_001522523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]