SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341525|ref|YP_001522689.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341525|ref|YP_001522689.1|
Domain Number - Region: 78-146
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00755
Family AAT-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158341525|ref|YP_001522689.1|
Sequence length 163
Comment hypothetical protein AM1_H0022 [Acaryochloris marina MBIC11017]
Sequence
MLKVSVNPRKSPDNLLDAFILSAMTEPLTFTAAAIVSLAFQKAIEAAGSETGKKFATSAY
ALIDQLRTKIWSKFKGKEKAEAALQKADAGNTEALNAVISYLNVEMLESEDFAKEIQQLA
HEINLHVIEDNSSQVQNNYGGTNYQNKISGGVVNQAETINIQN
Download sequence
Identical sequences A8ZQT9
gi|158341525|ref|YP_001522689.1| 329726.AM1_H0022 gi|158341525|ref|YP_001522689.1|NC_009933 WP_012168438.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]