SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333751|ref|YP_001514923.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333751|ref|YP_001514923.1|
Domain Number 1 Region: 327-519
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.61e-49
Family Ppx associated domain 0.002
Further Details:      
 
Domain Number 2 Region: 131-312
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.26e-44
Family Ppx/GppA phosphatase 0.00032
Further Details:      
 
Domain Number 3 Region: 4-126
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.61e-37
Family Ppx/GppA phosphatase 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333751|ref|YP_001514923.1|
Sequence length 532
Comment exopolyphosphatase [Acaryochloris marina MBIC11017]
Sequence
MQTIAAIDVGTNSIHMVVVKVNPEIPAFNIIDTEKSTVRLGEGSKDTGKLHPDAIARAIA
ALRRCQEVAAACKVEQIQAVATSAVREALNGRTFIRAVESELGLKINVISGPEEARRIYL
GVLSGIEFNKKPHVIVDIGGGSTELILGDGQDPRSLSSTKVGAVRLTEEYITTDPVSTRE
FERLQAYVRGMLEWPVEELRSHLSPGEIPTLIGTSGTIESILKLHACEVMGACPTSLHGH
VLTLDDLNELIRKLRKLNYEERCKMPGMTERRAEIILAGAVILAETMTLLKLDSITTCER
ALREGIVVDWMMKQGLIEDRLRYQGSVRERSVMNLAHQYHVELATAERIADFAVALFDQT
HGALHDWGIDERHSLWAAAILHNCGHYISHSAHHKHSYYLIRHGGLLGYTDAEVEIIANL
ARYHRKGPPKKKHENYQNLVNKTQRRIVDQLSAILKLAVALDRRQIGAIESLHCEMEEDT
ITLHLQASQADDDCALELWSLDMKKACFEAEFDVTLVAQLAESAPSPDLQPA
Download sequence
Identical sequences B0CD18
gi|158333751|ref|YP_001514923.1| 329726.AM1_0559 WP_012161209.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]