SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334273|ref|YP_001515445.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334273|ref|YP_001515445.1|
Domain Number 1 Region: 7-341
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.44e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 503-652,683-713
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000022
Family P22 tailspike protein 0.038
Further Details:      
 
Domain Number 3 Region: 341-477
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000129
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334273|ref|YP_001515445.1|
Sequence length 959
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MLPLRLLAPHPLQAQIIPDQTLPINSQVTANGNNIFIEGGTTAGNNLFHSFEEFSLTNTN
QATFNSVPAIDNIIGRVTGNSISNIDGVIKVNSNANLLFLNSNGIIFGPNSSLDIGGSFL
ASTAVGVQFQDGSVLSTANPQPPPLLTISRPTGLLFNGTQSGRIMVRGTLALPPSQTLAL
VGRNVQFNGGTAIVESGRIEVGSVSRGSVTLSPSAIGWNLKYNQVQAFSDIQLLSESALL
NPNVVSNPFGGIQIQGRHIRLNQSEVRAQTLADQPGADINVQASQSLEIGGEVDSFFPFS
SWIATVVERGAQGKGGRIRVDAPNLSIRDGGRIQTLSIGNGRSGNVLINADTLFLSGAAS
PTVNTRREFGNNLNTRISSENFGPGEGGRIDVNTGSLTLLDGGRITTVVGPFTLGNGGDI
AVNASQFIFAKEVNPFAIDSVSNISTITFGFGDAGNVNVSTQRLHLVNGAQISTRGIKIS
FGNQGFTPGAGNVGNVTVKADQAITVTGASQLAPDFISFLGSITNGTGKGGDVSILTQNL
TVEDGGSLSSAVFSSSINSGPLPPNIGEGNGGNLTIDAAKVNVIGINNSPFNPSPSILGT
FTLGPGNAGNTTINTQHLKVLEGGQINTGTLASGNAGRLFINATKSVLVKGRATNNLPAQ
IASNTLVLNEATRNAFFLPSQPTGNTGEVTIQSQHITLADGGRIGVQHIGSGNAGGLSIT
ADSVLLNNQGAIIAETASGEGGNLNLTVKDILQLRNNSLISTESEGLGNGGNININTQFL
IASPFENSDIIANAFDGDGGNITISTQGIFGFASRDTVTPFSDITASSQQGINGVIEINS
PEVDPSQSLVELPAVVPPLENIVQGCRPGQTLGGSSFTHIGRGGLPSGPGRYLTPHTVWQ
DLRPNHSAHLSAVHDHPNNSAIVKPPIQIVEAKGWTQDAQGRIYLTAQTTSSRPHGTGC
Download sequence
Identical sequences B0C1W5
329726.AM1_1091 gi|158334273|ref|YP_001515445.1| WP_012161685.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]