SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335652|ref|YP_001516824.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335652|ref|YP_001516824.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.23e-37
Family N-terminal domain of MutM-like DNA repair proteins 0.00024
Further Details:      
 
Domain Number 2 Region: 141-231
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.32e-30
Family Middle domain of MutM-like DNA repair proteins 0.00091
Further Details:      
 
Domain Number 3 Region: 231-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.27e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158335652|ref|YP_001516824.1|
Sequence length 284
Comment formamidopyrimidine-DNA glycosylase [Acaryochloris marina MBIC11017]
Sequence
MPELPEVETVRLGLEKVTVGMQIMGGEVLYPRTIAHPQSPQVFIQGLQDATFLSWMRRGK
YLLSQLSFSTQQPSGWLGVHLRMTGQLLWVAQDEPVQKHTRVRLFFVNNRELRFVDQRTF
GQMWWVAPTEDPKQVISGLQKLGPEPFSEEFSVDYFWESLQGRKRSIKSALLDQALVAGV
GNIYADEALFMSEIRPTTACHQLQTEQVQRLRTAIIEVLSTSIGAGGTTFSDFRDLKGVN
GNYGGMAWVYGRQGQPCRTCGQTIERIKLVGRSTHFCPQCQPES
Download sequence
Identical sequences B0C5D4
WP_012162970.1.67183 gi|158335652|ref|YP_001516824.1| 329726.AM1_2501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]