SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338239|ref|YP_001519416.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338239|ref|YP_001519416.1|
Domain Number 1 Region: 39-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-50
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 1630-1809
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-42
Family Histidine kinase 0.0036
Further Details:      
 
Domain Number 3 Region: 1831-1964
Classification Level Classification E-value
Superfamily CheY-like 1.37e-29
Family CheY-related 0.011
Further Details:      
 
Domain Number 4 Region: 1387-1566
Classification Level Classification E-value
Superfamily GAF domain-like 1.22e-26
Family GAF domain 0.0065
Further Details:      
 
Domain Number 5 Region: 1560-1642
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.61e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 6 Region: 335-620
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-19
Family Extended AAA-ATPase domain 0.048
Further Details:      
 
Weak hits

Sequence:  gi|158338239|ref|YP_001519416.1|
Domain Number - Region: 1262-1348
Classification Level Classification E-value
Superfamily TPR-like 0.00531
Family Tetratricopeptide repeat (TPR) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338239|ref|YP_001519416.1|
Sequence length 2040
Comment serine/threonine protein kinase and signal transduction histidine kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris marina MBIC11017]
Sequence
MGIFNILHSSKANDSSSICEDTIHAFNDGLTMTVDHITLSRYQILEQLYESSRTLVYRAH
NQVTQTDVVLKILKTPYPTAQELAEFRHEYEIARELDVPGVVQPTALLPYNNGLAIEMPD
FGGISLSDFATPSTEHGKPRSPMAIHIFLDIALQLAKALESLSQYQIIHKDIKPHNIVVH
PQTLETKLIDFSLASLLPRESTALLSPKLLEGTLLYLSPEQTGRMNRKVDYRTDFYSLGI
TFYELLTGQLPFQAQDPMELVHCHIAQVPVAPIVINPNIPEVLNQIVLKLIAKMAEDRYQ
TAYGLHYDLAYCRHLLQEQGQVSSFALAQEDQPTDFVIPEKLYGRTQEVEILLNTFERVA
QGASELMLVSGHSGVGKTAVISEIHKPIVRRRGYFIQGKFDQLQQSMPFAALLQAFQDLC
QQLLMESPESVKQWQTKILTAVGDNGQVIIDVIPEVELLIGPQPPVAELEPGPTLNRFNL
VFQQFFQIFPGVDHPLVLFLDDLQWIDSASLKFLQSLLEESERGYLLLIGTYRDNEVLDA
HPLMQTLRRLEQSELTISRLHLTALQAKDLNALISDTLACSPEQTCTLTQYLFQKTQGNP
FFSRQFLQTLEKEQLIRFNQTLRSWEWDITEIQALALTGDVVEFMRRQLLKLSPETQESL
KLAACIGNRFTLKTLAIVSGTSEEKTAQTLWEALQAGLLEGIKNVNLTEQIQAAIDENQP
LSIESRTSGLAPSISTYTFLHDRIQQAAYSLIPSGQKRATHLMIGQQLLKLVPEMERDEQ
IFELVNQLNRGATLLETSEEQVNLAELNRVAAKKARTSTAYDLAAEYASMGLTLLGKDGW
QQHYDLTLALSELAAEAAYLHSAIGTMESLVESILAHAAHPLDQVRAYEIQIQAYTSHNR
LLDALATARQALARFGIHFPESPQPEDIQAAFQDLAQETALFNVAEFGNLPVMLEQQQLA
VMGIAASMIPAAYIAAPDLFPLVTVLGVKTSIRHGNSPLGAFFYATYSILLTGVLQDIDL
ATEYSHLALQVMEKFDAKPVQPAVLYSLGAFVTHDSVHLQNAIALLREGYQIALDTGNLE
FVGYCAKDICQYSYFCGQDLGSLTSDIQAYVKILDKFQIATTASFTRLFWQVVLNLRGQN
QTPTQLVGKAYNEADVLPQMVSTSNVAGLHFYSVHKLVLGYLFHDRDHLQALADQARFYL
DGGPGYFTGTIYHFYDSLALLALVPTGSSIPEPWQERIEQNQAYLKRRAQYGPMNVQHKY
HLVEAERYRVLGAHLEAIDAYDLAISLATEHHFTQEAALAQELAARFYLQWGKTTIAQTY
MVNAYYAYERWGATAKLADLESNYAQLLAPFLNSGLRIQALESFSLARTQPTHSSHQGGF
KGLDWAAVMKACQALSEEIEIERLLATTMQVVIENAGAERGCLLLYQDQQLCLVAQHPEQ
AMQLPISLNHVGINGHLPLSLIHYSERTQETLVIQDGRTETKFAGDLYQINQAPLSQLCM
PILRQGDLVGLLYLENNLTPGAFTPNHLEVLHLLAAQAAISIDNAQLYASVEKKVAQRTQ
QLRTAQLEAEHANQAKSDFLASMSHELRTPLNAILGFSQLMAQDARLPQHLGESLAIINR
SGEHLLDLINDVLALSKIEAGKTTLQLDTFNFYEFLQAIHGMLQLRAKSKNLDFHFEQSP
DIPEVIQADERKLRQILINLLGNAIKFTEQGRVTLRVTNAHSQSEGLTPPDISVLQFEVE
DTGAGIAKDELDSVFEAFVQTQSGIKSRQGTGLGLPISQSFVQLMGGQLQVRSEEGIGTC
FFFNLPVLVTTTPVTHKPSQQKILRLAEDQPNYRILVVEDQVDNQRLLIDHLSPLGFMMA
AVNDGPSAIESWQSWRPHLIWMDLQLPGMNGLEVAKKIKDLAAASNSPPPIIIALTANAF
DDVRIQALANGCDGFVSKPYILTEILDLMAEKLNLSWIYEESTPVQPQTIPVRTLDPEHL
NRLPLTWREQLNQAALFLDEGKVVDLISEIEPNHQEIAASLYQLVKDYQFERLIHLTESS
Download sequence
Identical sequences B0C8E2
gi|158338239|ref|YP_001519416.1| WP_012165360.1.67183 329726.AM1_5135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]