SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338698|ref|YP_001519875.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338698|ref|YP_001519875.1|
Domain Number 1 Region: 5-241
Classification Level Classification E-value
Superfamily PP2C-like 6.8e-62
Family PP2C-like 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338698|ref|YP_001519875.1|
Sequence length 269
Comment serine/threonine protein phosphatase 2C [Acaryochloris marina MBIC11017]
Sequence
MKRLFAGLSDQGLVRKANQDSYRIDEPEGRFFIVADGMGGHAGGEEASRIAAETIQKFLV
ENWQAQLNPPDLLKKALLKANQDIIQNQKDFPERADMGTTVVVVLFPAEGQPWCAHIGDS
RLYRWRGSQLSQITEDHTWISQAVKSGLLTKDQARSHPWRHVLAQCLGREELDEIGIQQL
DVKSGDQLLLCSDGLTEELADEQIAPFFEAKHPCETVVDALVEAAKDEGGQDNITVVLVA
LGDGEEEESSSWADTPAMDDDPTGDLNEA
Download sequence
Identical sequences B0CF40
329726.AM1_5605 WP_012165776.1.67183 gi|158338698|ref|YP_001519875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]