SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167038553|ref|YP_001666131.1| from Thermoanaerobacter pseudethanolicus ATCC 33223

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167038553|ref|YP_001666131.1|
Domain Number 1 Region: 332-404,436-829
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.28e-97
Family Amylase, catalytic domain 0.000000393
Further Details:      
 
Domain Number 2 Region: 244-362
Classification Level Classification E-value
Superfamily E set domains 8.4e-26
Family E-set domains of sugar-utilizing enzymes 0.0011
Further Details:      
 
Domain Number 3 Region: 925-1013
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000199
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 4 Region: 1255-1350
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000245
Family Starch-binding domain 0.012
Further Details:      
 
Domain Number 5 Region: 829-919
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000166
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 
Domain Number 6 Region: 1159-1268
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000443
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  gi|167038553|ref|YP_001666131.1|
Domain Number - Region: 1503-1543
Classification Level Classification E-value
Superfamily SH3-domain 0.000463
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167038553|ref|YP_001666131.1|
Sequence length 1674
Comment alpha amylase [Thermoanaerobacter pseudethanolicus ATCC 33223]
Sequence
MFKRRTLGFLLSFLLIYTAVFGSMPVQFAKAETDTAPAIANVVGDFQSKIGDSDWNINSD
KTVMTYKGNGFYEFTTPVALPAGDYEYKVALNHSWEGGGVPSQGNLSLHLDSDSVVTFYY
NYNTSSVTDSTKYTPIPEEKLPRIVGTIQSAIGAGDDWKPETSTAIMRDYKFNNVYEYTA
NVPKGYYEFKVTLGPSWDINYGLNGEQNGPNIPLNVAYDTKITFYYDSVSHNIWTDYNPP
LTGPDNNIYYDDLKHDTHDPFFRSPFGAIKTGDTVTLRIQAKNHDLESAKISYWDDIKKT
RTEVPMYKIGQSPDGQYEYWEVKLSFDYPTRIWYYFILKDGTKTAYYGDNDEQLGGVGKA
TDTVNKDFELTVYDKNLDTPDWMKGAVMYQIFPDRFYNGDPLNDRLKEYSRGFDPVEYHD
DWYDLPDNPNDKDKPGYTGDGIWNNDFFGGDLQGINDKLDYLKNLGISVIYLNPIFQSPS
NHRYDTTDYTKIDELLGDLDTFKTLMKEAHARGIKVILDGVFNHTSDDSIYFDRYGKYLD
NELGAYQAWKQGDQSKSPYGDWYEIKPDGTYEGWWGFDSLPVIRQINGSEYNVKSWADFI
INNPNAISKYWLNPDGDKDAGADGWRLDVANEIAHDFWVHFRAAINTVKPNAPMIAELWG
DASLDLLGDSFNSVMNYLFRNAVIDFILDKQFDDGNVVHNPIDAAKLDQRLMSIYERYPL
PVFYSTMNLLGSHDTMRILTVFGYNSANENQNSQEAKDLAVKRLKLAAILQMGYPGMPSI
YYGDEAGQSGGKDPDNRRTFSWGREDKDLQDFFKKVVNIRNENQVLKTGDLETLYANGDV
YAFGRRIINGKDVFGNSYPDSVAIVVINKGEAKSVQIDTTKFVRDGVAFTDALSGKTYTV
RDGQIVVEVVALDGAILISDPGQNLTAPQPITDLKAVSGNGQVDLSWSAVDRAVSYNIYR
STVKGGLYEKIASNVTQITYIDTDVTNGLKYVYSVTAVDSDGNESALSNEVEAYPAFSIG
WAGNMNQVDTHVIGVNNPVEVYAEIWAEGLTDKPGQGENMIAQLGYRYIGDGGQDATRNK
VEGVEINKDWTWVDARYVGDSGNNDKYMAKFVPDMVGTWEYIMRFSSNQGQDWTYTKGPD
GKTDEAKQFIVVPSNDVEPPTALGLQQPGIESSRVTLNWSLSTDNVAIYGYEIYKSLSET
GPFVKIATVADTVYNYVDTDVVNGKVYYYKVVAVDTSFNRTASNIVKATPDIIPIKVIFN
VTVPDYTPDDGANIAGNFHDAFWNPSAHQMTKTGPNTYSITLTLNEGTQLEYKYARGSWD
KVEKGEYGEEIANRKITVVNQGSNTMVVNDTVQRWRDLPIYIYSPKDNTTVDANTNEIEI
KGNTYKGAKVTINDESFVQQENGVFTKVVPLEYGVNTTKIHVEPSGDKNNELTKDITITV
IREEPVQEKEPTPTPESEPAPMPEPQPTPTPEPQPSCNYGIVTASTLNLREGASITSKII
GTIPAGKVVKWLEEVNGWYKVDYNGKVGYVSTKYVSSVPDPSKVTVAKSVKVIVKSGLNV
RVSSSVAARKIGAVPYGTELKVVEERNGWYLVQYKDGFGYIYSVYTVDTKASVLKTVKVT
AKSGLNVRAGDSVKARKIGAVPYGTQLKVVGEYGAWYLIQYKNGFGYVYAKYTK
Download sequence
Identical sequences E8US26
gi|320116949|ref|YP_004187108.1| gi|167038553|ref|YP_001666131.1| 340099.Teth39_2173 WP_012269781.1.2934 WP_012269781.1.56562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]