SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183219943|ref|YP_001837939.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183219943|ref|YP_001837939.1|
Domain Number 1 Region: 222-289
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000576
Family TonB 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183219943|ref|YP_001837939.1|
Sequence length 296
Comment hypothetical protein LEPBI_I0525 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MPEKEEGEKRLFFAFTFVILLSSFFLAHLITRNMLWKMWAEEQTTETLGPKEQEKIYEVL
VEQQFINPDKKDEYKALSNKDSAGGGGITEKQGFHTLTQFREFIMGSAASTPSKVQPKSE
QTKDDDIFEFGIFKADPKTNSNAQESPNQSASAGQMTKIPFNFRFQQDFLFRWDGAKALT
IPTKQLAGYYYFKSMLKRIEESFAPPGGGNYAYRDMAGIVAREGIKEGETKVLFMLSEQG
QVLDVRLVSSQGQVVVDQACLDSIRGQNFGPVPEEVKAKGLIFGINFIFPGMRYYR
Download sequence
Identical sequences B0SJG3
456481.LEPBI_I0525 gi|183219943|ref|YP_001837939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]