SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183221285|ref|YP_001839281.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183221285|ref|YP_001839281.1|
Domain Number 1 Region: 35-252
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.3e-61
Family Endonuclease I 0.00000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183221285|ref|YP_001839281.1|
Sequence length 257
Comment endonuclease I [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MQKFLYSVLLLLFLCLAYTLLSEKKGDGIENKHSITDFQKAKRVLKRFYAKVGKDFYCGC
DFEKDEEELGRFKINHDSCGLKARKDSKRQTWIEWEHVVPAHSFGKERECWTKPNCESGG
KLLKGRKCCTATDPEFNLIEADLHNIVPVPGEINADRGIFPFGEIDGEPRAYGDCDFEIH
FKNAVAEPKQDIRGDIARIYLYMEWRYGIPIPEGKRDLYKSWSALDPPDTFEIRKNEIVE
RVQKQTNPFVDGTLKEP
Download sequence
Identical sequences B0SSB5
gi|183221285|ref|YP_001839281.1| gi|189911376|ref|YP_001962931.1| WP_012388883.1.33202 WP_012388883.1.95533 355278.LBF_1847 456481.LEPBI_I1902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]