SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183221435|ref|YP_001839431.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183221435|ref|YP_001839431.1|
Domain Number 1 Region: 475-698
Classification Level Classification E-value
Superfamily Fibronectin type III 4.36e-19
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number 2 Region: 930-978
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 3 Region: 817-911
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000943
Family Fibronectin type III 0.008
Further Details:      
 
Weak hits

Sequence:  gi|183221435|ref|YP_001839431.1|
Domain Number - Region: 702-794
Classification Level Classification E-value
Superfamily PKD domain 0.00286
Family PKD domain 0.017
Further Details:      
 
Domain Number - Region: 328-384
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00549
Family TSP type-3 repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183221435|ref|YP_001839431.1|
Sequence length 1088
Comment glycohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MTLFFYPLFRKCSTSLGEPTIFAFNNSKTGSKIKVKRIISTFVMSQLLVSCIAFLDFSKE
ADKKLESLGLVATSALNVGSATAGPSGKSITSDDGKFQVLIPPGAMDEEKTFSIRRFEIT
NSSLPNGYIPTTDAYEITPSYRFKKDVVITISQNVEKIEALNLAKNKAQGFVNSTTSDSD
NSGRVSGGWDGSLTTASSDKIQFQSRTFSIFGGGTPPPGNGAPNIVGAFYDFKPGSSFLP
FRVRAQVIEPDGDVMSVYLITGPVGQGTVAIRMVPEPGNWYSALIPYESMVQAGIQIQVL
AVDSYGNNTTRPSSDMFFYPVSSGNPAFVNNYDTDKDNDGYLDAWEGDNGFNPNNPSSPN
AALFPDSDGDGIPNVADHTPNGEANPQIDSISVIPNQARMYLDEKITFSILASYLGSPRY
VQSNFVTTGNALSGSPVGEFSDSVFQAIAPGIAGVQVTVGNFQATSTVTVVDTVPPNNIT
TLTAIAMSATRVRLRWQAPGNDGPFGKVSAYEIRRSSNNIDTDAKCSQASTIFHTLTPKN
AGSVEIWDANGHAPNTTYYYCIRAYDHNGNRNEWVSSNVSATTYVVGDTVRPSDVTTLTA
NALTDETVQLFWTAVGDDGTVGNASSYEIRRSASVINTDADCDNSHEVTNSISAVTVGTN
INFLVTQLSANTQYYFCVRAYDEVGNKSRWNGTVSATTLLGNIPPIANAGLDQMNAMVGT
QVNLNGTQSYDPDSGVCSANPASYVYQWSIISKPPSSNLTNGQINSGNQLNASFTPDVPG
QYALELRFTDSSSTCFGGPRMGSDIMQVTAYESDLIPPAQVTSFLGTGISQDQIQLTWLN
VGDDGMTGNINRYEIGISINPITNDTECQNAPWKHSPNISNFVPNAQVSAVIGGLFQNTT
YHLCIIGFDEVANRGQANVGLSVTTIAGTSGWGEWTQWSNCSARCGAGTRTRTRTCLDPI
AGCGGTNTETTACNLRNCYSNISVANNAANDTSHTLVCPTNYVRGPNMSVHVYTGLFKKH
VSDWFALGCGLYRGYTIVPNESTYTVTDIQNGVRIDFALPHPPPEDYPCTSNELYTNRNT
AIYCSEVP
Download sequence
Identical sequences B0SSR5
gi|183221435|ref|YP_001839431.1| 456481.LEPBI_I2053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]