SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362753|ref|YP_001655026.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166362753|ref|YP_001655026.1|
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0502
Family Di-heme elbow motif 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166362753|ref|YP_001655026.1|
Sequence length 148
Comment HNH endonuclease [Microcystis aeruginosa NIES-843]
Sequence
MISITTRLQVRARANYLCEYCHSPEEISAALFEVDHIQPKSLGGKDELANLALACQRCNR
YRYNFIKAIDPKTEQEVEIFNPRQQHWQEHFIWTPDALKIVGLTPIARATIERLDLNDDN
HNEGFIVKVRRLWIRGGWHPPSTDKKQE
Download sequence
Identical sequences A0A139GMH0 A0A1V4BWM6 B0JFP0 I4HTS1
449447.MAE_00120 WP_002797431.1.4043 WP_002797431.1.50331 WP_002797431.1.52201 WP_002797431.1.79847 gi|166362753|ref|YP_001655026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]