SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362825|ref|YP_001655098.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362825|ref|YP_001655098.1|
Domain Number 1 Region: 713-814
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000706
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 645-726
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000384
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166362825|ref|YP_001655098.1|
Sequence length 858
Comment hypothetical protein MAE_00840 [Microcystis aeruginosa NIES-843]
Sequence
MTLQEGTYIWEYGDTTQALWFTASYNTVTNQWTVDMKKGSMDLNAFWWSNGDSNADGNIV
LSKADNSLNMNGTGIVWDGYDKISDTGLTGTEHNGSSLLTAGNTYTYSYSKDQGVEIEAL
LAGGVTTLGVRATSVNGTDGIKAVDGQYVFVPYDTTPPTVTVNIVDASLNDGDNNSLVTF
QFSETVSGFTVGDVSVSGGTLSNFTQVDGNSYQATFTADDAVETTGSVSVAAASYSDVAG
NQGGAGTDTVTIDTKNPTLAVDIVDASLNDGDNNSLVSFEFSEDVAGFDNSDVSVSGGTL
SDFTQVDGNSYQATFTADDAVETTGSVSVAAASYSDVAGNDGGAGTDTVTIDTKNPTLAV
DIVDASLNDGDNNSLVSFEFSEDVAGFDNSDVSVSGGTLSDFTQVDGNSYTAIFTADDAV
ETTGSVSVAAASYSDVAGNDGGAGTDTVTIDTKNPTLAVDIVDASLNDGDNNSLVSFEFS
EDVAGFDNSDVSVSGGTLSDFTQVDGNSYQATFTADDAVETTGSVSVAADSYSDVAGNNG
GAGTDTVTIDTLNPTVGITFDNSPLTGQNFSTTITFQFSEAVSGFAASDVTLTNGVLSNF
TGSGSSYTATFIATNFQSPTGTVAVSNDYFDTPGNQGAANSANIAMTVGGGPDPNDGPSG
GGSVIGSGTIGADSITGSTGDDNLSGLDGNDTINGGDGNDTINGGTGADIISGGTGNDNI
IGLGGFDLIYGGSGNDTINGSNGIDTIVGGFGNDSLTGGGGDTFRFLSIYDQQDVITGFN
DTIVFDITGASAFTSLGSGALGTTTYTGAIAGGYLTYSGGVLSYDADGSAGSTFSPLAIV
TLTGSPTLSNTNVLFQNL
Download sequence
Identical sequences B0JFL9
WP_012263839.1.4043 gi|166362825|ref|YP_001655098.1| 449447.MAE_00840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]