SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362930|ref|YP_001655203.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362930|ref|YP_001655203.1|
Domain Number 1 Region: 4-295
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.28e-66
Family AstE/AspA-like 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166362930|ref|YP_001655203.1|
Sequence length 297
Comment aspartoacylase [Microcystis aeruginosa NIES-843]
Sequence
MIEQKTTIKNLALIAGVHGNELTPAYLVKYLQKSPNLIARSSFQSHSLIANPLALKQRFR
YIDTDLNRCFNQKDLVNPDCQQYEQKRAKKIVKEIREKSIDLLIDIHSTTSNMMLAIIYS
NPHPWLLKLFTYLTKINPDVRLIYHPVSEEENHFLKGICPLAFTLEIGPVNHGVICPYLF
RQTETLIYQILDYIEQENYLAAHLDTFSESLTVYQRLGSIDYPRDEQGEIKAMLHPQILQ
RDYQAIQPNQPIFLGFDGQEIIYRGESELYPIFVGESSYKEKGIALCWTAKKQIDIN
Download sequence
Identical sequences B0JLZ4 I4FPZ5
gi|166362930|ref|YP_001655203.1| WP_002760345.1.24258 WP_002760345.1.4043 449447.MAE_01890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]