SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362935|ref|YP_001655208.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166362935|ref|YP_001655208.1|
Domain Number - Region: 4-57
Classification Level Classification E-value
Superfamily STI-like 0.00392
Family Kunitz (STI) inhibitors 0.018
Further Details:      
 
Domain Number - Region: 89-115
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0174
Family Cytochrome c3-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166362935|ref|YP_001655208.1|
Sequence length 116
Comment hypothetical protein MAE_01940 [Microcystis aeruginosa NIES-843]
Sequence
MGNTIHTITENFRQPFIIINVEHDKINGITVLFFNFGNFSGHRLTTGTPISIKFCQGGFT
IAEGKIERCRFFRLRFQRYRTSGGLKPEENRYTKNNCRYCQQQISDFIGGCGGCHG
Download sequence
Identical sequences 449447.MAE_01940 gi|166362935|ref|YP_001655208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]