SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362955|ref|YP_001655228.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362955|ref|YP_001655228.1|
Domain Number 1 Region: 55-158
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.96e-24
Family Pentapeptide repeats 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166362955|ref|YP_001655228.1|
Sequence length 186
Comment hypothetical protein MAE_02140 [Microcystis aeruginosa NIES-843]
Sequence
MAYCYKIKNAHRWNFPPMKTIFRLAIAFFALLFILSPVNALAASSAAVTGANASYENQNL
TGKDFSGQNLQSAQFTNVNLQDSNFSSADLRGAVFNGASIIEGNFHGADLTNGLAYLSTF
KNSDLSDAIFAEAIMLRTIFEGVNINGADFSFAVLDAQQIKNLCERAEGVNSKTGISTPE
SLGCDQ
Download sequence
Identical sequences B0JM19
gi|166362955|ref|YP_001655228.1| 449447.MAE_02140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]