SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362995|ref|YP_001655268.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362995|ref|YP_001655268.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Phosphotyrosine protein phosphatases I 1.31e-33
Family Low-molecular-weight phosphotyrosine protein phosphatases 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166362995|ref|YP_001655268.1|
Sequence length 132
Comment arsenate reductase [Microcystis aeruginosa NIES-843]
Sequence
MKKVMFACRKNSCRSQIAEGFAKTLGAGKIAVTSSGLEAAKVHPGAIEVMQEIGIDITDQ
TSKSIRDFNPEDYDAVISLCGCGVNLPEGWVLQEIFEDWLIDDPDGQPIETFRRVRDEIK
AKVIGLIEQLSR
Download sequence
Identical sequences B0JM59
WP_012263959.1.4043 gi|166362995|ref|YP_001655268.1| 449447.MAE_02540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]