SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363045|ref|YP_001655318.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363045|ref|YP_001655318.1|
Domain Number 1 Region: 44-227
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000676
Family GAF domain 0.0099
Further Details:      
 
Domain Number 2 Region: 242-471
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000746
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363045|ref|YP_001655318.1|
Sequence length 474
Comment serine phosphatase [Microcystis aeruginosa NIES-843]
Sequence
MLSEPEPSDTLTTPTVNMGDHSTDIKPILALKELVASLYREQNKVQNLLSSLGFALRSFN
NLNQFLDLTPLMAARVADAEGGALILSKNNGQVALDQLHCQDNQINGELRRQLEAIIRQL
NQEPALENKNNRSLLDSLDHKIRQTLGQGTQVYSTPVLVKNSERGRLYVFSRDPDYGWTP
TRRKLLQLVADQTAVAIANNELTIELRSKERQDRELEIAAEIQNRLLPRQCPKIQGVELA
AHCQTANRVGGDYYDFIPCNYDQFKPATEAEREASAAPWSIVIGDVMGKGVPAGLLMTMT
RGMLRAEVLNRHSPAQILRHLNRVMYADLDNSHRFVTLFYSEYDPLTRRLGYSNAAHYPT
LWWRAKTGELESLDTEGTLVGLEADSIYDDAQVQLEAGDTLIYYTDGFTDAVNSKGERFD
QKNWLSAVKEACQQYTDPEQILEYLFGKVAAFTGLGNDSSDDMTLVVMRVKSEE
Download sequence
Identical sequences B0JMW2
gi|166363045|ref|YP_001655318.1| WP_012263996.1.4043 449447.MAE_03040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]