SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363171|ref|YP_001655444.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166363171|ref|YP_001655444.1|
Domain Number - Region: 77-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000524
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166363171|ref|YP_001655444.1|
Sequence length 239
Comment hypothetical protein MAE_04300 [Microcystis aeruginosa NIES-843]
Sequence
MLKNLAAVSTLVIPFLFFPTQAQAITINLATGLDASNTLITTGAQSDAHWTVDNPQGSST
TTPAQTVYPGNPNWFGGWLANGPNSTWIARDANTPANGLGTYTRAFDLTGVDLSTVSITG
SWAVDDTGILALNGQQIASLSAGAWGSLTPFSLAAGSSTAALLNQGQNQLTIRIIDPTDN
FLEGVRLQGTLTGSNAPTSVPEPTSTLSLLALGTLGAASTLKRKLKSSQSTEKETTEIG
Download sequence
Identical sequences B0JN88 I4HHH9
449447.MAE_04300 WP_002792105.1.13945 WP_002792105.1.4043 WP_002792105.1.98808 gi|166363171|ref|YP_001655444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]