SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363303|ref|YP_001655576.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363303|ref|YP_001655576.1|
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000556
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.36e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363303|ref|YP_001655576.1|
Sequence length 327
Comment pyruvate dehydrogenase E1 component beta subunit [Microcystis aeruginosa NIES-843]
Sequence
MAETLLFNALRQAIDEEMGRDQTVFVLGEDVGHYGGSYKVTKDLYKKYGDLRVLDTPIAE
NSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPMVIRGPGG
VGRQLGAEHSQRLEAYFHAVPGLKIVACSTPYNAKGLLKSAIRDNNPVLFFEHVLLYNLK
ENLPDTEYLLPLDKAEIVRKGEDITILTYSRMRHHCLQALKQLEKDGYDPEIIDLISLKP
FDMETIAASIRKTHRVIIVEECMKTAGIASELIALINEQLFDELDAPVLRLSSQDIPTPY
NGNLERLTIIQPNQIVEAVQKMVGDRI
Download sequence
Identical sequences A0A0A1VVD2 A0A1V4BZ73 A0A2H6L1Q0 B0JP73 I4F5Z8 I4GK31 I4IVF3
449447.MAE_05620 gi|166363303|ref|YP_001655576.1| WP_002752113.1.10452 WP_002752113.1.23084 WP_002752113.1.4043 WP_002752113.1.43950 WP_002752113.1.5315 WP_002752113.1.79847 WP_002752113.1.92877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]