SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363369|ref|YP_001655642.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363369|ref|YP_001655642.1|
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.74e-34
Family Ribosomal protein S15 0.0000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363369|ref|YP_001655642.1|
Sequence length 89
Comment 30S ribosomal protein S15 [Microcystis aeruginosa NIES-843]
Sequence
MALTQTKKQELISQYQAHETDTGSSELQVAFLTERINQLTEHLKANPKDHASRRGLLQMI
GRRRGLLTYIQKKDQQRYQTLIGRLGIRR
Download sequence
Identical sequences A0A0A1VX96 A0A0K1RXC8 A0A139GNH4 A0A1E4Q7G2 A0A1V4BQH6 A0A2H6L496 B0JPD9 I4FVB9 I4HGG7 I4IDK3 I4IVD2 L7E2B2
gi|166363369|ref|YP_001655642.1| WP_002738807.1.10452 WP_002738807.1.15998 WP_002738807.1.20667 WP_002738807.1.24258 WP_002738807.1.4043 WP_002738807.1.42333 WP_002738807.1.43950 WP_002738807.1.43975 WP_002738807.1.50331 WP_002738807.1.52201 WP_002738807.1.79847 449447.MAE_06280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]