SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363611|ref|YP_001655884.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363611|ref|YP_001655884.1|
Domain Number 1 Region: 7-78
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000226
Family PIN domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363611|ref|YP_001655884.1|
Sequence length 85
Comment hypothetical protein MAE_08700 [Microcystis aeruginosa NIES-843]
Sequence
MEKWLVFLLDTNIWLERLLGQAQAEVVAELLDTLSPSDMCMTDFTLHSIAVICNRLNQRE
VFIKFVDDVLIDAGVVLVSIPANGT
Download sequence
Identical sequences B0JQN3
449447.MAE_08700 gi|166363611|ref|YP_001655884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]