SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363689|ref|YP_001655962.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166363689|ref|YP_001655962.1|
Domain Number - Region: 15-219
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00549
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363689|ref|YP_001655962.1|
Sequence length 239
Comment hypothetical protein MAE_09480 [Microcystis aeruginosa NIES-843]
Sequence
MLDSLLDSSLTLSLKTPLILLVLIALEAVLSADNAIALASIAQGLGDHQRQRQALNIGLV
FAYILRMILILTATWVVKYWQFELLGAVYLLWLVFNYFASPEDKDHSHHSLQFHSLWQAI
PLIAVTDLAFSLDSVTTSIAVADDTWLILLGGTIGVVTLRFMAGLFIRWLEEYTHLEDAG
FVTVGLVGLRLLLRVISPDFVPPEWIMISLIAILFAWGFSKRNDREPIESDTIQSDELP
Download sequence
Identical sequences B0JRM0
WP_012264461.1.4043 449447.MAE_09480 gi|166363689|ref|YP_001655962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]