SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363844|ref|YP_001656117.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363844|ref|YP_001656117.1|
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-69
Family TK-like PP module 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363844|ref|YP_001656117.1|
Sequence length 274
Comment transketolase [Microcystis aeruginosa NIES-843]
Sequence
MKFAANQLRQTVLRMAFAGSTVHIGCAFSIIEILAVLYRSYLNLGNGQPESPGRDYLILS
KGHGVMAQYACMYELGWLTDKDIDNYFGDGTILKGLSDAHVPGLEVSSGSLGHGLSVGVG
IALASKIKGTGQRCFALVGDGEINEGSIWEALLFASHFQLSNLLVIVDANGYQAMGTTQE
VMNLGQIADKFRAFGFDCREVDGHDEKALYQVFQELLELSSSCPKAVIAHTVKGKGVSFM
EDNNVWHYSRLNREIYAQAKAELEPQVYKDKLSL
Download sequence
Identical sequences B0JSN1
449447.MAE_11030 WP_012264578.1.4043 gi|166363844|ref|YP_001656117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]