SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363896|ref|YP_001656169.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363896|ref|YP_001656169.1|
Domain Number 1 Region: 51-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-34
Family Clostridium neurotoxins, the second last domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166363896|ref|YP_001656169.1|
Sequence length 735
Comment hypothetical protein MAE_11550 [Microcystis aeruginosa NIES-843]
Sequence
MSNASNDLVLHLKLDTIIPDGGNQRVRSALTENFLASSENVSAFTESQYRSHGNPQFVSD
EHFGSCFIFDGRQDYIEIPNSEDINFATNQDFTVASWIKIAKEQPFKTNGDNDIIEKWNG
SGGYPYVIRYMRDSQTIHAARYDGSNNPSITTTTKLNSEQFYHIAFVKEGSKLRLYLDGH
EENSTDDTTQSQTQNDSPLYLARRGGSNEAYANYFAGTIAHLRIYKKALSPEEIKQDIND
NLTVIAAFNLAYPLDFDLYEGDNKESIIFIENDTKGEELVFEIQNDTEQGITLPAKSGAV
SQNNYHFELRFRPDTLSPKSLQQLAFKPQSNWSMSSPVTQADGIVSLYFLTTNTTLSANE
VVTLTLQNVSASAAGGARTTRVEFLCPEFTYQGETLTHYYREKKLSVIDHRGKKNIPLHV
SFVGSNRILNDGTTTNKLTLRIVNVLKDKSIPLIPDSKGDNASKFIISFDVQEEGQNKDW
ALGTTSQVQGIGIQGTDFRLTARHIEEWKIVKETQGESPTWTITNQNEENVELRQEQGIE
LIVSNILSSLPSGQTNLYIRYENIPGYWDGTFICTIEKSPILFDERGKVGMGITPGTEQL
KVKGDTAITGKFSLGQLIANYDSGWFDVEINKNYKKEHNLGTFLLVTQILFKDTNGRIWD
AKTTLRRVNDGDFQNSYCGYYLLMPDHNTFDFATAGQAVFAADNTSTYGPERKSQRFTKG
SYRIFAWRIGATLNE
Download sequence
Identical sequences B0JST3
449447.MAE_11550 gi|166363896|ref|YP_001656169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]