SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363927|ref|YP_001656200.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166363927|ref|YP_001656200.1|
Domain Number - Region: 326-352
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0998
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166363927|ref|YP_001656200.1|
Sequence length 428
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MLVVEAKLKNGTLEQYHRLDEAIRTSQFVRNSCVRYWMDHKGTTRNDLQKLCSVLANNKE
TPWVNKLNSQARQSAADRAWQSINRFYQNCHAKIPGKKGFPRFKKHSRSVEYKLTGYQLS
DDRRKIRFTDGFKAGEFDLWCSQKTLVYYSEQQIRRVRVVRRADGYYCQFLIDVERQEYH
KPTGQITGIDLGLKEFYTDAQGNTVENPRYLRKSEKRLQKAQRRLSKKFRKGKKQSKNYH
KQRVKVAKLHLKVSRQRKDKAIKDALALVQSNDLVVYEALKVRNLVKNRKLAKSISDASW
YQFTEWLNYFAKIYRIVCVAVPPHFTSQDCSVCGTRVQKTLSTRTHQCPNCQTVLDRDHN
AAINILKKGLKYLGNHLNGTVGQTETDPNALGESGLWIFSGDIENLSCLVEQGISDSDLE
RIPRHSVA
Download sequence
Identical sequences B0JSW4
gi|166363927|ref|YP_001656200.1| WP_012264645.1.4043 449447.MAE_11860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]