SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364182|ref|YP_001656455.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364182|ref|YP_001656455.1|
Domain Number 1 Region: 251-412
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.42e-35
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 141-222
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000883
Family Homodimeric domain of signal transducing histidine kinase 0.0083
Further Details:      
 
Domain Number 3 Region: 17-151
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000116
Family GAF domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166364182|ref|YP_001656455.1|
Sequence length 418
Comment two-component sensor histidine kinase [Microcystis aeruginosa NIES-843]
Sequence
MPFSSPSRTPLSDDFIALCQTQMELLREQMETDRSAVYLTEPLSSNLIPVVVYPPFNPPS
PQKKRLSLQPGQPAADLLTAVKLEDLSHLWGNQETVSSHRLFLPLMYEEGMIGLLVTTRE
KRPWQSWELTRMEKITQTLALACVLDRQLGEERYYRQWQRQRLDTFLHQIRNPLTALKTF
GKLLLKRLLAEEGNDPAITGILRESDRVRDLIAEFEAQIQQESENYPTVDIPLLQAQSSP
TAFLLPAGSGQLAPIDLHDILDPLLLSAQAVAKERNLSLETIHGEDIPLICANIPGLREV
FSNLIDNALKYTPAGGKVTVEVQNVKNSVEIVFKDTGYGIARSDQERIFQRHYRGVQAGG
DIPGTGLGLAIAKELITSMGGTIEFISPNPEQTSSLYPGTVFRVHIPVIADDNLSIEG
Download sequence
Identical sequences B0JU75 I4I0U7
449447.MAE_14410 WP_002798555.1.4043 WP_002798555.1.50331 gi|166364182|ref|YP_001656455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]