SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364216|ref|YP_001656489.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364216|ref|YP_001656489.1|
Domain Number 1 Region: 398-642
Classification Level Classification E-value
Superfamily ThiG-like 1.57e-82
Family ThiG-like 0.000000375
Further Details:      
 
Domain Number 2 Region: 21-230,313-372
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-41
Family FAD-linked reductases, N-terminal domain 0.0044
Further Details:      
 
Domain Number 3 Region: 225-312
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.85e-22
Family D-aminoacid oxidase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166364216|ref|YP_001656489.1|
Sequence length 658
Comment thiamine biosynthesis protein [Microcystis aeruginosa NIES-843]
Sequence
MSLNQESLAFSHGRVKNSTSEILIVGGGIIGLAIAVDLQLRGAKVTLLVRDIAQAASRAA
AGMLAPHAEGIPPGPFLDLCLQSRWLYPEWSRKIEDLTGINSGYYPCGILAPVYELDQPF
TTEEVNKIWLDSNAVHLYQPGLGKDVVGGWWYPDDGQVDNRQLVTGLQQAAENLGVEIRQ
GIEVHAIQQKQGKVKSIYTSIGELEAKIYILAAGAWTSQLLPLPIHPVKGQMAAVKMPPN
QTLARVLFGPQTYLVPRRNGRLIIGATSEKVAWQTGNTPQGLQTLFERATRLYPPLADWE
IEEMWWGFRPGTADELPILGRSSCDNLILATGHYRNGILLAPVTASLIADLVINDKVNPI
LTHFSCDRFKRPSPLTIPPMSLTIIENKPQALLSPQNDRLTIAGKTFHSRLMTGTGKYAN
LTTMQESITASECQIVTVAVRRVQTNAPGHEGLAAAIDWSKIWMLPNTAGCQTAEEAIRV
ARLGREMAKLLGQEDNNFIKLEVIPDPKYLLPDPIGTLQAAEQLVKEGFAVLPYINADPL
LAKRLEEAGCATVMPLGSPIGSGQGLKNEANIAIIIESAQIPVVVDAGIGTPSEAARAME
MGADALLINSAIAMAANPAMMAQAMAMAAKAGRLAYLAGRMPIKSYASPSSPLTGTIA
Download sequence
Identical sequences B0JUA9
WP_012264864.1.4043 gi|166364216|ref|YP_001656489.1| 449447.MAE_14750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]