SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364322|ref|YP_001656595.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364322|ref|YP_001656595.1|
Domain Number 1 Region: 1-138,211-343
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.44e-64
Family Carboxypeptidase T 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364322|ref|YP_001656595.1|
Sequence length 553
Comment carboxypeptidase A2 [Microcystis aeruginosa NIES-843]
Sequence
MFDFSHYYPYAELVSFLKNLASSYPNLISLTSIGKSYENRDIWLTTLTNQATGHYLEKPA
YWIDANTHAGEVTGSAVALYTISHLLRQYGHNSQITRLLDHYTVYILPRLAVDGAEKYLT
TPYLLRSSIRPYPHTDEKPGLYPEDINGDGLILQMRQKDTCGAWKISEQDPRIMVRREPE
EFEGTFYTLLTEGLIRDYDGYNFTTAPTLEGLDFNRNYPVYWVPEGEQQGAGDFPFSEPE
TRAEAEFWANNTNINGFVTYHTYSAVMLRPYSTHPDEYFPVEDLEMYKYIADKGKAMTGY
ECVSVYHDFRYHPKEVTNGAMDDYGYDHFGWYGFTVELWDAPTQAGVKKDDYIQWFRWHP
LEDELKLQRWNDENLAGKGFINWQSFDHPQLGEVEIGGWDFKNVWQNAPEKYLPDLCEKQ
CQFTIAHALMSPLLAISRLDLKSEGNGIYHLVLQLENQGFLPTYTSKKALERKIVRPIQV
KLNLADEVSLIVGKLEQEIGHLEGRSNKVYSSLAHGLDYRCTVEWVIKGVSGQEIEIIAI
AERAGTVRQKVIL
Download sequence
Identical sequences B0JV69
WP_012264942.1.4043 449447.MAE_15810 gi|166364322|ref|YP_001656595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]