SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364455|ref|YP_001656728.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166364455|ref|YP_001656728.1|
Domain Number - Region: 333-370
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00289
Family Transcriptional factor domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364455|ref|YP_001656728.1|
Sequence length 419
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MITLTYQYKLKVNRQQEREIVHILDVGKSVYNYALSERKDWLNSRKCLADRCSLVSEYII
PADEPYPNYFVQAKNLTEAKKVYPILKTVNAQVLQQVLKTLDKAFDQIKSKGFGFPRFKK
KMRSLVFPALSKNFLGDGCLNFPQLGKIRIRPSREYPSGFEPKQARIIQKASGFYVSVSF
QSTELVPDMTVGKTCLGIDAGIESFVATSRGDLIKAPRFLLKVQSKLKLLQRRLKRKTKG
SNNWLKLQDKIARLHEKVSNTRRDWHFKLAHYLGDFADNIFVEDINFVSWSRGIVRKQSL
DSGIGSFINEILPFVVWKRGKYYLKVDKNGTSQDCPNCGAITGKKALSERVHRCDSCGHI
EPRDTASAKVIENRGKNAVGLTVLENACGGDLTGVVQLNLFDLVKSLRTKNPPLHRASG
Download sequence
Identical sequences B0JW56
WP_012265042.1.4043 gi|166364455|ref|YP_001656728.1| 449447.MAE_17140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]