SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364804|ref|YP_001657077.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166364804|ref|YP_001657077.1|
Domain Number - Region: 36-85
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0651
Family Cytochrome c3-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166364804|ref|YP_001657077.1|
Sequence length 384
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MWINFDQLLDLPNVTVVNYQKIAQTIFLKLALLNETIECPNCHQTLDRINQTEYNLVRDL
SILGNPVYLEVPRRQFHCQKCQKYISERLSFMRLRQHHTIRYESMIYERVKNCSIEEISR
EEGLGWEEVELIFNHCAKELEKEEWEAPERISLDEFSNLKGHKDFITTVVDMDKKILLDV
IKGHKQEELMEALKARPVAVREKVKEVSVDMWSGFTAVIKELFPNAKIIYDRFHVMAIIN
DELNNLRKLMGVHEKGLPHLLWKNKEDLKDEQKQQLEVILKEHPCLGIAWEMKEEIRQIY
QSSKTFRGAERKLEKWIRIGGILYESSASMIQKHLQGICNYFENHTTNGLIEGMNTKIKL
IKRMSYGFTNFEHLRLKLFACFNS
Download sequence
Identical sequences B0JXQ8
WP_012265305.1.4043 449447.MAE_20630 gi|166364804|ref|YP_001657077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]