SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364896|ref|YP_001657169.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364896|ref|YP_001657169.1|
Domain Number 1 Region: 745-859
Classification Level Classification E-value
Superfamily CalX-like 8.37e-26
Family CalX-beta domain 0.00071
Further Details:      
 
Domain Number 2 Region: 800-952
Classification Level Classification E-value
Superfamily beta-Roll 1.26e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0005
Further Details:      
 
Domain Number 3 Region: 257-378
Classification Level Classification E-value
Superfamily CalX-like 1.57e-17
Family CalX-beta domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|166364896|ref|YP_001657169.1|
Domain Number - Region: 389-462
Classification Level Classification E-value
Superfamily Cadherin-like 0.000454
Family Cadherin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364896|ref|YP_001657169.1|
Sequence length 1049
Comment Na-Ca exchanger/integrin-beta [Microcystis aeruginosa NIES-843]
Sequence
MPISGTPYIYNDAGTIGPAGGPFPNQQSLSNTVREVSLGTPTLIQGVYEYIWHHGCGPTA
AGMVIGYWDRNGFPNLIPGDSTTQTNEVNEAIASSGHYNDYSLPRDDEHTGLLQDRSVFG
GAHSSDSLADFMRTSWSSISNYYGWSWFDDVDDAIIGYTNYQGYAQFNSWNEVWGGFTWD
DFVNEINNARPMVFLVDTDGNGGTDHFVTAIGYDATTRQYACHDTWDGAAVRWFDFSQIS
SGKRWGIYGATFIQPPKPTISLSVSPSSISENASGNLVYTFTRTGTKTNPLTVNYLVGGS
ATFNTDYTQVGATSFTGTSGTVTFAANSPTATLTVSPTIDTNITEGDETVALTLVTGTDY
NIGTTTAVTGTILNNDYPTDILLTKIPAVGNLPIGTLLGNFSTVDPDVGDAFTYSLISGL
GDRDNSRFILVGNQLKTNALLNTQDPFDFSIRVRTTDLGGLSYEEIIPIRSLIGDAWGDV
HFLNFDRRVDQKPGVDSWFHQQSVGDFILVKSTVDGWQIQTRQEPWFYDSRVSVNTAFST
QTEGYKIIFDQDFEPDKKLKIDGAKMTLTSGQFLTVGNSLIQRQDNVYTLIYAGADRRLY
TADDDRLIAWDNGNHINITVLPSYERVGLMQGFLGNGDGNRSNDFALRDGTLLPADPSWE
QLHGVWADSWRVRQSESLFDTPSPDAPSPPRITLDDLPPDQVQAAIDAAIRVGIPDEALD
AVALDSVITQDQGFLDGAANQFSPRFSITSSSVAEENSDSHAVRLTVNLSIPSTRIVTVD
YATQDGTGNHPAIAGSDYTATNGTLTFHPGTTALTLDIPIVGDTGLEFDESFSVNLTNPN
GAILGTDRGNVTILNDDVNALPTFVGTSGNDVFAGGDDNDIINGREGDDNLNGGAGDDIL
NGGPGKDVLTGGTGADTFVYQNFTDSLFANPDRLRSFNPDEGDRIYLVTTPDATFNAGII
SAANLTEAVNLAYADADPNTPGMQTLGVNQAVFFSFGATTTTRRSYLAVNDNISGYNAAS
DLFIEVTGMVGTLSTGLLVSNNYFFDALG
Download sequence
Identical sequences B0JFX2
gi|166364896|ref|YP_001657169.1| 449447.MAE_21550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]