SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365077|ref|YP_001657350.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365077|ref|YP_001657350.1|
Domain Number 1 Region: 97-223
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.55e-37
Family NlpC/P60 0.0000155
Further Details:      
 
Domain Number 2 Region: 11-83
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 7.23e-20
Family Spr N-terminal domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365077|ref|YP_001657350.1|
Sequence length 225
Comment hypothetical protein MAE_23360 [Microcystis aeruginosa NIES-843]
Sequence
MKIISIPPSSTQEYLCIRDLNLYNSPSCQELATQAQQGRQLKFISLEITEKGLQIQLRED
NYLAWLCGEDLDAIALATTAYQKIPLTRSDIEKHIPEIITFTQEARNRTNHYLWGGTLAP
NYDCSGLIQAAFATFGIWLPRDSYQQEAFCQKINREELLPGDLIFFGDKRVNHVALYLGN
NQYIHSSGKETGNNGIAINLLTDDRDSVSRHYYQKLWSFGRVMHN
Download sequence
Identical sequences B0JH06
gi|166365077|ref|YP_001657350.1| WP_012265497.1.4043 449447.MAE_23360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]