SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365183|ref|YP_001657456.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365183|ref|YP_001657456.1|
Domain Number 1 Region: 20-211,312-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.71e-90
Family Bacterial dinuclear zinc exopeptidases 0.000017
Further Details:      
 
Domain Number 2 Region: 195-313
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.14e-29
Family Bacterial exopeptidase dimerisation domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166365183|ref|YP_001657456.1|
Sequence length 407
Comment N-acyl-L-amino acid amidohydrolase [Microcystis aeruginosa NIES-843]
Sequence
MISSFPVPNSLNCPQIRLAIRCLQPQLVHWRRQIHQKPELGFQEHLTASLISQTLTKYGI
EHQTGIAGTGIVATIEGSQPGPVLALRADMDALPIAEENQVPYRSQHPGQMHACGHDGHT
AIALGTAVYIAQNRHDVKGTVKIIFQPAEEGPGGAKPMIEAGVLKNPDVDGIIGLHLWNN
LPLGTVGVKNGPLMAAVECFDLQIQGRGGHGAIPHQTVDSLLVAAQIVNALQTIVARNLN
PLDAAVVTVGKLAAGTARNVIADSANLSGTVRYFNPQLGGYFRQRMEEIIAGICQSQGAS
YQFDYWQLYPPVINHDQMAELVRSIAAQVVETPAGIVPECQTMGGEDMSFFLQEVPGCYF
FLGSANPELGLAYPHHHPRFDFDESVLAMGVEIFVRCVEKFCNSRTF
Download sequence
Identical sequences B0JHB2
WP_012265578.1.4043 449447.MAE_24420 gi|166365183|ref|YP_001657456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]