SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365446|ref|YP_001657719.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365446|ref|YP_001657719.1|
Domain Number 1 Region: 254-633
Classification Level Classification E-value
Superfamily SIS domain 8.54e-104
Family double-SIS domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 2-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.72e-65
Family Class II glutamine amidotransferases 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365446|ref|YP_001657719.1|
Sequence length 633
Comment glucosamine--fructose-6-phosphate aminotransferase [Microcystis aeruginosa NIES-843]
Sequence
MCGIVGYIGTQTAIDILLAGLERLEYRGYDSAGIATILEGELHRVRAQGKLYNLREKLEQ
EVNPSQIGIGHTRWATHGKPVESNAHPHTDNSQRVAVVQNGIVENFQVLRTELKEKGCIF
DSETDTEVIPHLIASYLPKPTDEDYLGVSPFLKAVLRAIERLEGAFALGVISPDYPDELI
VVRQHAPLIIGFGQGEFFCASDVSALVPHTRAVLSLDNGEIARLTPLGVEIYNFEGKRVR
KSPRVLDWSPTTVEKQGYRHFMLKEIYEQPGVVRDCLGTYLHPHWTAQNEDNVNPININF
SEEIYDNLEHIQILACGTSWHASLVGKYLIEQLAGIPTRVQYASEFRYAPTPLMPNTLTI
GVTQSGETADTLAALETEKQRRLGLEKKYQARIIGITNRPESTLAQMVDQIINTQAGIEI
GVAATKSFTAQLLGFYLLALDLSYRRQTLSLERIEEIINGMRSLPRSIETVLETQEKAIE
ELAHEFNDTQDFIFLGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLDAKVP
VVAIAMPGIVYDKVLSNAQEAKARDARLLGVVADSDTEAPKVFNDLLYVPEIEELLSPIL
TVIPLQLLSYHIAARRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences B0JIM9
WP_012265785.1.4043 449447.MAE_27050 gi|166365446|ref|YP_001657719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]