SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365558|ref|YP_001657831.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365558|ref|YP_001657831.1|
Domain Number 1 Region: 6-344
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.35e-75
Family AAT-like 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166365558|ref|YP_001657831.1|
Sequence length 348
Comment histidinol-phosphate aminotransferase [Microcystis aeruginosa NIES-843]
Sequence
MLPTRDCVRQTPAYTPGEQPQTAGFTKLNTNENPYPPPAEIFAHLQEQLEKVRLYPDPIS
KELRQTAAELYGIAADQIIAGNGSDDILNIALRTFVNPCESVAFLDLTYSLYETIARVHG
ANIIEFPTNDKFALEGPIICPEAKLIFLASPNPPLGKHLDRDYLEATCANASGLVLIDEA
YVDFSDDNHLDFLSRYDNVIISRTMSKSYSLAGLRVGFGFASRAIIEQMDKVRDSYNLDR
IAQTLATAALKHHNYFEQVWQKVRQTRGRLITSLRELGFIVFDSEANFILASPPQISASE
LYNQLKERQILVRYFKHPRIQNYVRISIGTDGEIDRLLSAIQEIMGTN
Download sequence
Identical sequences B0JJJ7
WP_012265860.1.4043 gi|166365558|ref|YP_001657831.1| 449447.MAE_28170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]