SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365592|ref|YP_001657865.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365592|ref|YP_001657865.1|
Domain Number 1 Region: 91-239
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.92e-30
Family Single-domain sulfurtransferase 0.011
Further Details:      
 
Weak hits

Sequence:  gi|166365592|ref|YP_001657865.1|
Domain Number - Region: 234-256
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0327
Family Rad50 coiled-coil Zn hook 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166365592|ref|YP_001657865.1|
Sequence length 270
Comment rhodanese-like domain-containing protein [Microcystis aeruginosa NIES-843]
Sequence
MSYLVATFYQFVALSDYRQKQPEIQKYCQERGIKGTILLAAEGINATIAGNSLAIAEVIS
WLKTDTRLANLEVKESVCDYLPFQRLKIRLKKEIVTFGQPKANPLEKTGIHLKTEEWNQL
LKEPDVVVIDTRNNYEVALGTFAGSLNPEIQHFRQFPEYIYDNFDRINNKKIALFCTGGI
RCEKAAAFLLNQGFSQVYQLEGGILKYLEEVSPDQSLWQGECFVFDQRVALTANLEVGHY
EMCPACGHPIDEKDKQSPNYQAGISCPYCS
Download sequence
Identical sequences B0JJN1
gi|166365592|ref|YP_001657865.1| 449447.MAE_28510 WP_012265880.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]